DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment me31B and eIF4A

DIOPT Version :9

Sequence 1:NP_523533.2 Gene:me31B / 34364 FlyBaseID:FBgn0004419 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:367 Identity:147/367 - (40%)
Similarity:226/367 - (61%) Gaps:2/367 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDP 122
            :.|::..|:.|||.||:..|:|:||.||:.||...:.|:||:|:|::|||||..:.|.:|:|||.
  Fly    30 DNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDT 94

  Fly   123 TKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRI 187
            :....|||::.||||||.|..::.:.|.:::.:......|||.:::|...:.....:::.||||:
  Fly    95 SIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRV 159

  Fly   188 LDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKH 252
            .|::::||....:.::.||||||::||..|:..:..|...||.|.|::|.|||.|..|.......
  Fly   160 YDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCF 224

  Fly   253 LREPYEINL-MEELTLKGVTQYYAFV-QERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKI 315
            :|:|..|.: .|||||:|:.|:|..| ||..|:..|..|:..|.|.||:||||:.::|:.|.:::
  Fly   225 MRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEM 289

  Fly   316 TELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYL 380
            :...:....:|..|.|..|..:...||.|..|.|:.:||..||||||.|::|||:|.|...|.|:
  Fly   290 SIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYI 354

  Fly   381 HRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIP 422
            |||||.||||..|:|||.||.:||..|..||:...|.|:.:|
  Fly   355 HRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
me31BNP_523533.2 PTZ00424 60..422 CDD:185609 146/363 (40%)
DEADc 60..260 CDD:238167 74/199 (37%)
HELICc 270..398 CDD:238034 55/128 (43%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 147/367 (40%)
DEADc 32..232 CDD:238167 74/199 (37%)
Helicase_C 254..358 CDD:278689 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451590
Domainoid 1 1.000 91 1.000 Domainoid score I403
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9764
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.