DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and EFB1

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_009398.1 Gene:EFB1 / 851260 SGDID:S000000003 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:95/260 - (36%)
Similarity:127/260 - (48%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVEALDKFWADKSRYDLAEKRFYEG----PQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTL 62
            |:|.|.:..|     .||:|.:.||    ...||....:.....|.::...||.:..::.|..  
Yeast     8 KIETLKQLNA-----SLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKADEFDSF-- 65

  Fly    63 DDGLNSELAKRLAQLEGEHKELKTQVSLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEAND 127
                                                                 |...|...| .:
Yeast    66 -----------------------------------------------------PAASAAAAE-EE 76

  Fly   128 DDDDVDLFGSDSEEEDGEAARIREERLAAYAAKK-AKKVQIIAKSNIILDVKPWDDETDLKVMET 191
            :||||||||||.||.|.||.:::.||:|||.||| ||..:..|||.:.||||||||||:|:.|..
Yeast    77 EDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAKSIVTLDVKPWDDETNLEEMVA 141

  Fly   192 EIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            .::.|..:||.|||.:|:|:.|||:||.|:|||||||||:|.|.:.||:.||.|||.||||..|:
Yeast   142 NVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL 206

  Fly   257  256
            Yeast   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 12/21 (57%)
EF1B 168..256 CDD:238181 51/87 (59%)
EFB1NP_009398.1 GST_C_family <12..57 CDD:413470 12/49 (24%)
EF1_GNE 123..206 CDD:395597 48/82 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346434
Domainoid 1 1.000 119 1.000 Domainoid score I1272
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 1 1.000 - - otm46563
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.