DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and AT5G12110

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_196772.1 Gene:AT5G12110 / 831084 AraportID:AT5G12110 Length:228 Species:Arabidopsis thaliana


Alignment Length:159 Identity:72/159 - (45%)
Similarity:101/159 - (63%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LKLTNGVS--KEPEVEAKKPEAN---DDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKV 165
            :::..||:  .|.....::|.|:   |||||:|||..::|:|...|    |||.|  |.|..||.
plant    76 VRVGGGVAPPSEAHPHTEEPAADGDGDDDDDIDLFADETEDEKKAA----EEREA--AKKDTKKT 134

  Fly   166 QIIAKSNIILDVKPWDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVS 230
            :...||:::|:|||||||||:|.:|..:|.:...||.|||||.|||.:||:||:|...:.||.||
plant   135 KESGKSSVLLEVKPWDDETDMKKLEEAVRSVQMPGLTWGASKLVPVGYGIKKLTIMMTIVDDLVS 199

  Fly   231 IDWLTEE---IEKLEDFVQSVDIAAFNKI 256
            :|.|.|:   .|...:::|||||.|||||
plant   200 VDNLIEDHLTSEPNNEYIQSVDIVAFNKI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 8/21 (38%)
EF1B 168..256 CDD:238181 46/90 (51%)
AT5G12110NP_196772.1 GST_C_family <5..63 CDD:413470
EF1B 137..228 CDD:238181 46/90 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1858
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X680
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.