DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and AT2G18110

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_179402.1 Gene:AT2G18110 / 816323 AraportID:AT2G18110 Length:231 Species:Arabidopsis thaliana


Alignment Length:149 Identity:74/149 - (49%)
Similarity:98/149 - (65%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VSKEPEVEAKKPEA-NDDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIIL 175
            |:..|..::|...| .:|||||||||.::|||...|    |||.|:..|...||..  .||::::
plant    89 VATPPAADSKDTAAEEEDDDDVDLFGEETEEEKKAA----EERAASVKASTKKKES--GKSSVLM 147

  Fly   176 DVKPWDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEE--- 237
            |:||||||||:|.:|..:|.|..:||.|||||.|||.:||:||.|.|.:.||.||||.:.||   
plant   148 DIKPWDDETDMKKLEEAVRSIQMEGLFWGASKLVPVGYGIKKLHIMCTIVDDLVSIDTMIEEQLT 212

  Fly   238 IEKLEDFVQSVDIAAFNKI 256
            :|.:.::|||.||.|||||
plant   213 VEPINEYVQSCDIVAFNKI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 10/21 (48%)
EF1B 168..256 CDD:238181 48/90 (53%)
AT2G18110NP_179402.1 GST_C_family <1..63 CDD:295467
EF1_GNE 145..231 CDD:279125 46/85 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1858
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.