DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and EFCC1

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001364429.1 Gene:EFCC1 / 79825 HGNCID:25692 Length:599 Species:Homo sapiens


Alignment Length:285 Identity:58/285 - (20%)
Similarity:92/285 - (32%) Gaps:109/285 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RFYEGPQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTLDDGLNSELAKRLAQLEGEHKELKT 86
            |...|..:|..|:.         :||:.:..||.::          .||.....|:.|       
Human   273 RLRRGQAEVRRRAE---------EARQVVLRSLHRV----------RELEALAQQVPG------- 311

  Fly    87 QVSLLNELLTATVKRLETQL-------------KLTNGVSKEPEVEAKKPE-------------- 124
                    |...|:|||.:|             :|.|   .||..::.:||              
Human   312 --------LQRWVRRLEAELQRYRSEDSQLPTPQLAN---PEPGDKSNEPEDAGTRDPDPTPEGA 365

  Fly   125 ----------ANDDDDDVDLFGS-----DSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNII 174
                      |.|:..|..||.|     .|:||:.|..|.:||:....|..|....::.:...  
Human   366 WQSDSSSGSRALDEAVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLARLSSCRG-- 428

  Fly   175 LDVKPWDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVE-------------- 225
                ..||:|..|:|       |..|...||:.  ....|..:..|:.:||              
Human   429 ----RCDDQTAEKLM-------TYFGHFGGANH--AHTLGELEACIAMLVEQLRTQGCGGRTLGT 480

  Fly   226 -DDKVSIDWLTEEIEKLEDFVQSVD 249
             :::..:....||.|.|...:|.|:
Human   481 SEEEAELQQKVEENEHLRLELQMVE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 10/26 (38%)
EF1B 168..256 CDD:238181 19/97 (20%)
EFCC1NP_001364429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CCD48 18..599 CDD:406280 58/285 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..127
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..198
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.