DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and Efcc1

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006236917.1 Gene:Efcc1 / 685202 RGDID:1596494 Length:575 Species:Rattus norvegicus


Alignment Length:205 Identity:46/205 - (22%)
Similarity:82/205 - (40%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PQKVTDRSHYSPL---VSEIAKAR-------EHIQNSL--------EKIDGVTLDDGLNSELAKR 73
            |.::|.|..::.|   .|..|.:|       |||:..:        .:....:|..|...|   |
  Rat   122 PPELTFRQFHARLCGYFSSRAGSRLPRGALSEHIETQIRLRRPRRRRRPGSPSLHGGAYGE---R 183

  Fly    74 LAQLEGEHKELKTQVSLLNELLTATVKR-LETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGS 137
            :|.||.|:..|:..|..|...|.::..| |..|:.|....|..||..|.:.:...        |:
  Rat   184 VAHLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQSDIPEAAAHELQRAQ--------GA 240

  Fly   138 DSEEEDGEAARIR----EERLAAYAAKKA--------KKVQIIAKSNIILDVKPWDDETDLKVME 190
            .:|.| ..|.|::    |.||....|::|        ::::.:|:....|       :..::.:|
  Rat   241 LAEAE-ARARRLQRGQVEVRLRTEEARQAVRRSLHRVRELESLARRVPRL-------QRQVQRLE 297

  Fly   191 TEIRKITQDG 200
            .|:|:...:|
  Rat   298 AELRRYRSEG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 8/25 (32%)
EF1B 168..256 CDD:238181 6/33 (18%)
Efcc1XP_006236917.1 CCD48 7..575 CDD:292427 46/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.