DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and Eef1b2

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_061266.2 Gene:Eef1b2 / 55949 MGIID:1929520 Length:225 Species:Mus musculus


Alignment Length:247 Identity:106/247 - (42%)
Similarity:137/247 - (55%) Gaps:48/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAEKRFYEGPQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTLDDGLNS--------ELAKRL 74
            ||:|.:.||         |.|..:::|        ..|.:.|....|..::        ...|..
Mouse    19 LADKSYIEG---------YVPSQADVA--------VFEAVSGPPPADLCHALRWYNHIKSYEKEK 66

  Fly    75 AQLEGEHKELKTQVSLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGSDS 139
            |.|.|..|.|.              |...:.::.|.|   ....:||      ||||:||||||.
Mouse    67 ASLPGVKKSLG--------------KYGPSSVEDTTG---SGAADAK------DDDDIDLFGSDD 108

  Fly   140 EEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETEIRKITQDGLLWG 204
            |||..||.::||||||.|.:|||||..::|||:|:|||||||||||:..:|..:|.|..|||:||
Mouse   109 EEESEEAKKLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWG 173

  Fly   205 ASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            :||.|||.:||:||.|.||||||||..|.|.|:|...||:|||:|:||||||
Mouse   174 SSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 15/21 (71%)
EF1B 168..256 CDD:238181 55/87 (63%)
Eef1b2NP_061266.2 GST_C_eEF1b_like <3..62 CDD:198341 11/59 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..115 20/64 (31%)
EF-1_beta_acid 103..130 CDD:287546 17/26 (65%)
EF1_GNE 142..225 CDD:279125 52/82 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.