DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and eef1b2

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001006877.1 Gene:eef1b2 / 448658 XenbaseID:XB-GENE-966955 Length:228 Species:Xenopus tropicalis


Alignment Length:259 Identity:110/259 - (42%)
Similarity:143/259 - (55%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VEALDKFWADKSRYDLAEKRFYEGPQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTLDDGLN 67
            ::.|::|.||||        :.||         |.|..:::|     :.::|.......|...|.
 Frog    12 LKVLNEFLADKS--------YIEG---------YVPSQADVA-----VFDALSGAPPADLFHALR 54

  Fly    68 -----SELAKRLAQLEGEHKELKTQVSLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEAND 127
                 ....|:.:.|.|..|.|.....:..|..|.:.                    ||..:..|
 Frog    55 WYNHIKSYEKQKSSLPGVKKPLGNYGPVNIEDTTGST--------------------AKDTKEED 99

  Fly   128 DDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETE 192
            ||||:||||||.|||:.|:.|:||||||.|.|||:||..:||||:|:|||||||||||:..:|..
 Frog   100 DDDDIDLFGSDDEEENEESKRVREERLAQYEAKKSKKPALIAKSSILLDVKPWDDETDMAKLEEC 164

  Fly   193 IRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            :|.|..:||:|||||.|||.:||:||.|.||||||||..|.|.|.|...||||||:|:||||||
 Frog   165 VRSIQMEGLVWGASKLVPVGYGIKKLQIQCVVEDDKVGTDVLEENITAFEDFVQSMDVAAFNKI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 15/21 (71%)
EF1B 168..256 CDD:238181 57/87 (66%)
eef1b2NP_001006877.1 GST_C_eEF1b_like <3..62 CDD:198341 14/71 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..122 23/71 (32%)
EF-1_beta_acid 106..133 CDD:371151 18/26 (69%)
EF1_GNE 145..228 CDD:376378 53/82 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.