Sequence 1: | NP_609361.1 | Gene: | eEF1delta / 34363 | FlyBaseID: | FBgn0032198 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001112372.1 | Gene: | cars1 / 368284 | ZFINID: | ZDB-GENE-030328-29 | Length: | 824 | Species: | Danio rerio |
Alignment Length: | 318 | Identity: | 66/318 - (20%) |
---|---|---|---|
Similarity: | 106/318 - (33%) | Gaps: | 120/318 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 WADKSRYDLAEKRFYEG---------PQK------------VTDRSHYSPLVSEIAKAREHIQ-- 51
Fly 52 ------NSLEKID-----GVT-LDDGLNSELAKRLAQ---LEGEHKELKTQVSLLNELLTATVKR 101
Fly 102 LETQLKLTNGVSKEPEVEAKKPEANDDDDDVD-LFGSDSEEEDGEAARIREERLAAYAAKKAKKV 165
Fly 166 -----------QIIAKSNIILDVKPWDDE--TDLKVMET------------------EIRKITQD 199
Fly 200 G--------LLWGASKF-----------VPVAFGIQK--------LSISCVVEDDKVS 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1delta | NP_609361.1 | EF-1_beta_acid | 134..>156 | CDD:287546 | 3/21 (14%) |
EF1B | 168..256 | CDD:238181 | 23/110 (21%) | ||
cars1 | NP_001112372.1 | GST_C_CysRS_N | 2..74 | CDD:198343 | |
PTZ00399 | 85..822 | CDD:240402 | 66/318 (21%) | ||
CysRS_core | 108..523 | CDD:173899 | 64/306 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2092 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |