DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and cars1

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001112372.1 Gene:cars1 / 368284 ZFINID:ZDB-GENE-030328-29 Length:824 Species:Danio rerio


Alignment Length:318 Identity:66/318 - (20%)
Similarity:106/318 - (33%) Gaps:120/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WADKSRYDLAEKRFYEG---------PQK------------VTDRSHYSPLVSEIAKAREHIQ-- 51
            |:.....|:::.|.|..         |||            |.|.||       :..||.:|.  
Zfish    96 WSPPEGTDISKLRLYNSLTRTKEVFVPQKGNRVLWYCCGPTVYDASH-------MGHARSYISFD 153

  Fly    52 ------NSLEKID-----GVT-LDDGLNSELAKRLAQ---LEGEHKELKTQVSLLNELLTATVKR 101
                  .:..|.|     .:| :||    ::.||..|   ||...::..:...:|.::|||    
Zfish   154 ILRRILKNYFKYDVFYCMNITDIDD----KIIKRARQNYLLEQYREKKPSAAQILQDVLTA---- 210

  Fly   102 LETQLKLTNGVSKEPEVEAKKPEANDDDDDVD-LFGSDSEEEDGEAARIREERLAAYAAKKAKKV 165
             .|..|.....:.:|:   ||......|..|| ..|........:||:...::.|....::||.:
Zfish   211 -RTPFKAKLAETTDPD---KKQMLERLDSAVDAALGPLQVAVQSKAAQDSIQKQAQVLLEEAKDL 271

  Fly   166 -----------QIIAKSNIILDVKPWDDE--TDLKVMET------------------EIRKITQD 199
                       |:...|...|..|.|:.|  .|::.:..                  .::||..:
Zfish   272 LSDWLDSQFGSQVTENSIFSLLPKYWEGEYHKDMEALNVLPPDVLTRVSEYVPEIVEFVKKIVDN 336

  Fly   200 G--------LLWGASKF-----------VPVAFGIQK--------LSISCVVEDDKVS 230
            |        :.:..:||           ||.|.|.||        ||||.    |::|
Zfish   337 GYGYESNGSVYFDTAKFDSCPAHSYAKLVPEAVGDQKALQEGEGDLSISA----DRLS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 3/21 (14%)
EF1B 168..256 CDD:238181 23/110 (21%)
cars1NP_001112372.1 GST_C_CysRS_N 2..74 CDD:198343
PTZ00399 85..822 CDD:240402 66/318 (21%)
CysRS_core 108..523 CDD:173899 64/306 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.