DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and Eef1b2

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001102269.1 Gene:Eef1b2 / 363241 RGDID:1311415 Length:225 Species:Rattus norvegicus


Alignment Length:249 Identity:108/249 - (43%)
Similarity:137/249 - (55%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAEKRFYEGPQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTLDDGLNS--------ELAKRL 74
            ||:|.:.||         |.|..:::|        ..|.|.|....|..::        ...|..
  Rat    19 LADKSYIEG---------YVPSQADVA--------VFEAISGPPPADLCHALRWYNHIKSYEKEK 66

  Fly    75 AQLEGEHKELKT--QVSLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEANDDDDDVDLFGS 137
            |.|.|..|.|..  .||:.:                |.|   ....:||      ||||:|||||
  Rat    67 ASLPGVKKSLGKYGPVSVAD----------------TTG---SGAADAK------DDDDIDLFGS 106

  Fly   138 DSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETEIRKITQDGLL 202
            |.|||..:|.|:||||||.|.:|||||..::|||:|:|||||||||||:..:|..:|.|..|||:
  Rat   107 DDEEESEDAKRLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLV 171

  Fly   203 WGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            ||:||.|||.:||:||.|.||||||||..|.|.|:|...||:|||:|:||||||
  Rat   172 WGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 15/21 (71%)
EF1B 168..256 CDD:238181 55/87 (63%)
Eef1b2NP_001102269.1 GST_C_eEF1b_like <3..62 CDD:198341 12/59 (20%)
EF-1_beta_acid 103..130 CDD:402289 17/26 (65%)
EF1_GNE 142..225 CDD:395597 52/82 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.