DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and eef1b2

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_956243.1 Gene:eef1b2 / 335370 ZFINID:ZDB-GENE-030131-7310 Length:225 Species:Danio rerio


Alignment Length:260 Identity:113/260 - (43%)
Similarity:142/260 - (54%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VEALDKFWADKSRYDLAEKRFYEGPQKVTDRSHYSPLVSEIAKAREHIQNSLEKIDGVTLDDGLN 67
            ::.|:.|.||||        :.||         |.|..::||     :.::|..:....|...|.
Zfish    12 LKVLNNFLADKS--------YIEG---------YVPSQADIA-----VFDALSGVPSADLCHALR 54

  Fly    68 -----SELAKRLAQLEGEHKELKTQVSLLNELLTATVKRLETQLKLTNGVSKEPEVEAKKPEAND 127
                 ....|....|.|..|.|...                       |.:...:..|..|.|.|
Zfish    55 WYNHIKSFQKEKGSLPGVKKPLGQY-----------------------GPAGVEDTTAAAPAAAD 96

  Fly   128 -DDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMET 191
             ||||:|||||| ||||.|||:|:|||||||.||||||..:||||:|:|||||||||||:..:|.
Zfish    97 EDDDDIDLFGSD-EEEDEEAAKIKEERLAAYNAKKAKKPALIAKSSILLDVKPWDDETDMAKLEE 160

  Fly   192 EIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            .:|.|..|||:||.||.:||.:||:||.|:||||||||..|.|.|.|...||:|||:|:||||||
Zfish   161 CVRSIQLDGLVWGQSKLLPVGYGIKKLQIACVVEDDKVGTDQLEELITAFEDYVQSMDVAAFNKI 225

  Fly   257  256
            Zfish   226  225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 17/21 (81%)
EF1B 168..256 CDD:238181 55/87 (63%)
eef1b2NP_956243.1 GST_C_eEF1b_like <3..62 CDD:198341 15/71 (21%)
EF1_GNE 142..225 CDD:279125 51/82 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.