DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and tef5

DIOPT Version :9

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_588303.1 Gene:tef5 / 2539275 PomBaseID:SPCC1450.04 Length:214 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:85/160 - (53%)
Similarity:109/160 - (68%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KRLET-QLKLTNGVSKEPEVEAKKPE--ANDDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKK 161
            |::.| .|....|.:|  ||.|..||  |..::|::|||||| ||||.||.||:.||:|.|..||
pombe    58 KQIATYDLATLPGTAK--EVSAYGPEGAAAAEEDEIDLFGSD-EEEDPEAERIKAERVAEYNKKK 119

  Fly   162 AKKVQIIAKSNIILDVKPWDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVED 226
            |.|.:.:.||.:.||||||||||.:..:|..:|.|..|||:||.||.|||.||:.|..|:.||||
pombe   120 AAKPKAVHKSLVTLDVKPWDDETPMDELEKAVRSIQMDGLVWGLSKLVPVGFGVNKFQINLVVED 184

  Fly   227 DKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            ||||::.|.||:|..||:|||.||||.:|:
pombe   185 DKVSLEALQEELEGFEDYVQSTDIAAMSKL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 15/21 (71%)
EF1B 168..256 CDD:238181 50/87 (57%)
tef5NP_588303.1 GST_C_eEF1b_like <3..63 CDD:198341 1/4 (25%)
EF-1_beta_acid 93..116 CDD:287546 16/23 (70%)
EF1B 126..214 CDD:238181 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1409
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.