DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1delta and EEF1B2

DIOPT Version :10

Sequence 1:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001950.1 Gene:EEF1B2 / 1933 HGNCID:3208 Length:225 Species:Homo sapiens


Alignment Length:129 Identity:85/129 - (65%)
Similarity:103/129 - (79%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKPWDDETDLKVMETE 192
            ||||:||||||.|||..||.|:||||||.|.:|||||..::|||:|:|||||||||||:..:|..
Human    97 DDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEEC 161

  Fly   193 IRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDFVQSVDIAAFNKI 256
            :|.|..|||:||:||.|||.:||:||.|.||||||||..|.|.|:|...||:|||:|:||||||
Human   162 VRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:463158 16/21 (76%)
EF1B 168..256 CDD:238181 55/87 (63%)
EEF1B2NP_001950.1 GST_C_eEF1b_like <3..62 CDD:198341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..115 13/17 (76%)
EF-1_beta_acid 103..130 CDD:463158 18/26 (69%)
EF1_GNE 142..225 CDD:459919 52/82 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.