DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo4.2

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001015822.1 Gene:lmo4.2 / 548539 XenbaseID:XB-GENE-479327 Length:167 Species:Xenopus tropicalis


Alignment Length:152 Identity:71/152 - (46%)
Similarity:95/152 - (62%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140
            |.|.|||.||:||:|||:::||||..||||.||.|.|.|:|:||:|:.|:|||:.||..:||.||
 Frog    22 KACAGCGGKIADRFLLYSMERYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGSSG 86

  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205
            .||.||::||.||:|.:|.                ..|:||:||:||.|.:.|.||||:..:..:
 Frog    87 ACSACGQSIPASEMVMRAQ----------------GSVYHLKCFTCATCRNRLVPGDRFHYVNGA 135

  Fly   206 LVCEQDWHK-LLKG---PANSN 223
            :.||.|... ||.|   |..||
 Frog   136 IFCEHDRPTGLLSGHLNPLQSN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 32/53 (60%)
LIM 142..212 CDD:413332 25/69 (36%)
lmo4.2NP_001015822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
LIM1_LMO4 24..78 CDD:188772 32/53 (60%)
LIM2_LMO4 88..142 CDD:188773 25/69 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7332
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4203
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 1 1.000 - - oto103836
Panther 1 1.100 - - LDO PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17344
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.