DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo4.1

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_012816296.1 Gene:lmo4.1 / 448304 XenbaseID:XB-GENE-971939 Length:173 Species:Xenopus tropicalis


Alignment Length:148 Identity:72/148 - (48%)
Similarity:94/148 - (63%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140
            |.|.|||.||:||:||||:|.|||:.||||.||.|.|.|:|:||:|:.|:|||:.||..:||.||
 Frog    21 KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGNSG 85

  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205
            .||.||::||.||||.:|...                |:||:||:|:.|.:.|.||||:..:..|
 Frog    86 ACSACGQSIPASELVMRAQGN----------------VYHLKCFTCSTCRNRLVPGDRFHYINGS 134

  Fly   206 LVCEQDW-HKLLKGPANS 222
            |.||.|. ..|:.|..||
 Frog   135 LFCEHDRPTALINGHLNS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 33/53 (62%)
LIM 142..212 CDD:413332 27/69 (39%)
lmo4.1XP_012816296.1 LIM1_LMO4 23..77 CDD:188772 33/53 (62%)
LIM2_LMO4 87..141 CDD:188773 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7332
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4927
Inparanoid 1 1.050 155 1.000 Inparanoid score I4203
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45787
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.150

Return to query results.
Submit another query.