DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and LMO2

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_005565.2 Gene:LMO2 / 4005 HGNCID:6642 Length:227 Species:Homo sapiens


Alignment Length:141 Identity:54/141 - (38%)
Similarity:74/141 - (52%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVC 142
            ||||...|.|||.|.|:|:|||..||.|..||..|.|||...:.:.|..||::||..:||..|:|
Human    99 CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLC 163

  Fly   143 SGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLV 207
            :.|.:.|...|:..:                :.:.|:||.||.||.|......||||.::.:.:|
Human   164 ASCDKRIRAYEMTMR----------------VKDKVYHLECFKCAACQKHFCVGDRYLLINSDIV 212

  Fly   208 CEQD---WHKL 215
            ||||   |.|:
Human   213 CEQDIYEWTKI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 26/53 (49%)
LIM 142..212 CDD:413332 21/72 (29%)
LMO2NP_005565.2 LIM1_LMO2 99..154 CDD:188770 27/54 (50%)
LIM2_LMO2 163..218 CDD:188771 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.