DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and LHX1

DIOPT Version :10

Sequence 1:NP_609359.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens


Alignment Length:136 Identity:50/136 - (36%)
Similarity:67/136 - (49%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVC 142
            |.||...|.||:||..|||.||..|::|..|...|.|   .||:|.|.:.||.|:...||..  |
Human     4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTE---KCFSREGKLYCKNDFFRCFGTK--C 63

  Fly   143 SGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDR-YTMLGASL 206
            :||.:.|.||:||.:|.:.                ||||.||:|..|...|..|:. |.:.....
Human    64 AGCAQGISPSDLVRRARSK----------------VFHLNCFTCMMCNKQLSTGEELYIIDENKF 112

  Fly   207 VCEQDW 212
            ||::|:
Human   113 VCKEDY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_609359.1 LIM1_LMO4 78..132 CDD:188772 24/53 (45%)
LIM 142..212 CDD:413332 22/70 (31%)
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753 24/53 (45%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 22/70 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187
Homeodomain 181..237 CDD:459649
dnaA <263..>382 CDD:455861
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.