DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and CG4328

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:175 Identity:54/175 - (30%)
Similarity:77/175 - (44%) Gaps:43/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVC 142
            |..|...|.|||::..::..:|.|||||..|...|..   ||:.|.|.:.|:.||..:: ....|
  Fly   199 CAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVH---SCYAREGKLYCRVDYERLY-IRNHC 259

  Fly   143 SGCGETIPPSELVAKALTGINNIDLQNQQKQIINC---VFHLRCFSCAKCGSSLRPGDRYTMLGA 204
            .|||..|...|||                   :.|   ||||:||:|..||:.|:.|::|.:...
  Fly   260 LGCGLKIAADELV-------------------MRCHENVFHLKCFACVVCGALLKKGEQYVVKQG 305

  Fly   205 SLVCEQDWHK---LLKG---------PANSNGTLGQRKGKVGRPR 237
            .|.|..|:.|   :|:|         |...:|..|.:     |||
  Fly   306 QLFCRFDYEKEVEMLQGYDFYGDELFPPKLDGRRGPK-----RPR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 19/53 (36%)
LIM 142..212 CDD:413332 23/72 (32%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 20/54 (37%)
LIM 259..313 CDD:295319 23/72 (32%)
COG5576 <332..439 CDD:227863 6/19 (32%)
HOX 341..393 CDD:197696 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.