DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and zgc:56628

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_956566.1 Gene:zgc:56628 / 393242 ZFINID:ZDB-GENE-040426-1099 Length:172 Species:Danio rerio


Alignment Length:161 Identity:78/161 - (48%)
Similarity:95/161 - (59%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SNDFN------NQQLIH--SNSLI-KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEV 115
            |:.||      |.|..|  ..:|. |.|.|||.|||||:||:|||.|||..||||.||.|.|||:
Zfish     7 SDPFNMVNSACNTQAAHVRMGALAWKRCVGCGCKISDRFLLFALDGYWHCHCLKCSCCQAQLAEI 71

  Fly   116 GSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFH 180
            ||||||:|||||||.||..:||.||.|..||.:||.:|:|.:|...                |||
Zfish    72 GSSCFTKRGLILCKSDYLRLFGHSGACRACGTSIPANEMVMRAQGN----------------VFH 120

  Fly   181 LRCFSCAKCGSSLRPGDRYTMLGASLVCEQD 211
            ::||.|:.|.:.|.||||:......|.||:|
Zfish   121 VKCFVCSICHNQLVPGDRFHYANGKLYCERD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 40/53 (75%)
LIM 142..212 CDD:413332 24/70 (34%)
zgc:56628NP_956566.1 LIM 34..88 CDD:295319 40/53 (75%)
LIM2_LMO4 98..152 CDD:188773 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.