DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Awh

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:168 Identity:53/168 - (31%)
Similarity:77/168 - (45%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IKVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCS 139
            ::.|..||:.||||:.|......||..||:|..|...| :...|||.|...:.||.|||..||..
  Fly     5 LRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPL-DRQQSCFIRERQVYCKADYSKNFGAK 68

  Fly   140 GVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGA 204
              ||.|...|..|:.|.:|.                ..||||.||:|.:||..|..|:::.::..
  Fly    69 --CSKCCRGISASDWVRRAR----------------ELVFHLACFACDQCGRQLSTGEQFALMDD 115

  Fly   205 SLVCEQDWHKLLKGPANS-----NGTLGQRKGKVGRPR 237
            .::|:..:.:.::|...|     :|. |..|.|..|.|
  Fly   116 RVLCKAHYLETVEGGTTSSDEGCDGD-GYHKSKTKRVR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 21/53 (40%)
LIM 142..212 CDD:413332 19/69 (28%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 21/53 (40%)
LIM2_AWH 69..123 CDD:188765 19/69 (28%)
Homeobox 152..204 CDD:278475 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.