DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo4b

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_997854.2 Gene:lmo4b / 324849 ZFINID:ZDB-GENE-030131-3570 Length:165 Species:Danio rerio


Alignment Length:136 Identity:68/136 - (50%)
Similarity:89/136 - (65%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140
            |.|.|||.||:||:||||:|.|||:.||||.||.|.|.|:|:||:|:.|:|||:.||..:||.||
Zfish    21 KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGNSG 85

  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205
            .||.||::||.||||.:|...                |:||:||:|:.|.:.|.||||:..:..|
Zfish    86 ACSACGQSIPASELVMRAQGN----------------VYHLKCFTCSTCRNRLVPGDRFHYINGS 134

  Fly   206 LVCEQD 211
            |.||.|
Zfish   135 LFCEHD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 33/53 (62%)
LIM 142..212 CDD:413332 28/70 (40%)
lmo4bNP_997854.2 LIM1_LMO4 23..77 CDD:188772 33/53 (62%)
LIM2_LMO4 87..141 CDD:188773 28/70 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7097
eggNOG 1 0.900 - - E33208_3BFEA
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4927
Inparanoid 1 1.050 155 1.000 Inparanoid score I4268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109625
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.