DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo2

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_571186.1 Gene:lmo2 / 30332 ZFINID:ZDB-GENE-980526-419 Length:159 Species:Danio rerio


Alignment Length:152 Identity:55/152 - (36%)
Similarity:78/152 - (51%) Gaps:26/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVC 142
            ||||...|.||:.|.|:::|||..||.|..||..|.|||...:.:.|..||::||..:||..|:|
Zfish    30 CGGCQQSIGDRFFLKAIEQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLC 94

  Fly   143 SGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLV 207
            :.|.:.|...|:..:                :.:.|:||.||.||.|......||||.::.:.:|
Zfish    95 ASCEKRIRAFEMTMR----------------VRDKVYHLECFKCAACQKHFCVGDRYLLINSDIV 143

  Fly   208 CEQD---WHKLLKGPANSNGTL 226
            ||||   |.||       ||::
Zfish   144 CEQDIFEWTKL-------NGSI 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 24/53 (45%)
LIM 142..212 CDD:413332 21/72 (29%)
lmo2NP_571186.1 LIM1_LMO2 30..85 CDD:188770 25/54 (46%)
LIM2_LMO2 94..149 CDD:188771 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.