DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Lmx1a

DIOPT Version :10

Sequence 1:NP_609359.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001099437.2 Gene:Lmx1a / 289201 RGDID:1304784 Length:382 Species:Rattus norvegicus


Alignment Length:206 Identity:62/206 - (30%)
Similarity:86/206 - (41%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ENFAPIVIDYRNSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISD 87
            |||             :..:||:::.||                .|..:.|...||.||...|||
  Rat     9 ENF-------------QSAIETSASFSS----------------LLGRAVSPKSVCEGCQRVISD 44

  Fly    88 RYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPS 152
            |:||...|.:||..|::|..|...|.   ::||.|...:.||..|..:|...  |.||.|.|.|:
  Rat    45 RFLLRLNDSFWHEQCVQCASCKEPLE---TTCFYRDKKLYCKYHYEKLFAVK--CGGCFEAIAPN 104

  Fly   153 ELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWHK--- 214
            |.|.:|            ||.    |:||.||.|..|...|:.||.:.:....|:|:.|:.|   
  Rat   105 EFVMRA------------QKS----VYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERE 153

  Fly   215 --LLKGPANSN 223
              .|..||.|:
  Rat   154 LLSLVSPAASD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_609359.1 LIM1_LMO4 78..132 CDD:188772 21/53 (40%)
LIM 142..212 CDD:413332 23/69 (33%)
Lmx1aNP_001099437.2 LIM1_Lmx1a 35..86 CDD:188756 21/53 (40%)
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 23/69 (33%)
Homeodomain 196..252 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.