DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo1

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_021333063.1 Gene:lmo1 / 280646 ZFINID:ZDB-GENE-021115-6 Length:179 Species:Danio rerio


Alignment Length:139 Identity:56/139 - (40%)
Similarity:78/139 - (56%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140
            |.|.||..||.|||||.|||:|||..||||.||...|.||||:.:|:..||||::||..:||.:|
Zfish    45 KGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTG 109

  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205
            .|:.|.:.||..|:|.:|...                |:||.||:|..|......||::.:....
Zfish   110 NCAACSKLIPAFEMVMRARDN----------------VYHLDCFACQLCNQRFCVGDKFFLKNNM 158

  Fly   206 LVCEQDWHK 214
            ::|:.|:.:
Zfish   159 ILCQMDYEE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 32/53 (60%)
LIM 142..212 CDD:413332 17/69 (25%)
lmo1XP_021333063.1 LIM1_LMO1_LMO3 47..101 CDD:188774 32/53 (60%)
LIM2_LMO1_LMO3 111..165 CDD:188775 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.