DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Lmo1

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_038954443.1 Gene:Lmo1 / 245979 RGDID:621166 Length:199 Species:Rattus norvegicus


Alignment Length:232 Identity:50/232 - (21%)
Similarity:85/232 - (36%) Gaps:71/232 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NFAPIV---IDYRNSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKI 85
            |.|.:|   :....:|.|...:|..::..|:.|..::.:....:.::|          ||     
  Rat     3 NGAKLVCRCLSLHQTNRTNRGLEAPTSRLSAHLHLLELAQQKGSEEEL----------GG----- 52

  Fly    86 SDRYLLYALDRYWHNGC----------LKCHCC-----GAMLAE----VGSSCFTRRGLIL---- 127
                 |..|:....|.|          |....|     |.|.::    |||......||:|    
  Rat    53 -----LRPLEHLAKNCCEWGGSGLPVLLSLELCSQQLRGGMPSQRDHCVGSPRNLFWGLVLGEKW 112

  Fly   128 -CKKDY---SSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAK 188
             |...:   ..:||.:|.|:.|.:.||..|:|.:|...                |:||.||:|..
  Rat   113 CCPGSFILRKRLFGTTGNCAACSKLIPAFEMVMRARDN----------------VYHLDCFACQL 161

  Fly   189 CGSSLRPGDRYTMLGASLVCEQDWHKLLKGPANSNGT 225
            |......||::.:....::|:.|:.:     .:.|||
  Rat   162 CNQRFCVGDKFFLKNNMILCQMDYEE-----GHLNGT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 17/77 (22%)
LIM 142..212 CDD:413332 17/69 (25%)
Lmo1XP_038954443.1 LIM2_LMO1_LMO3 131..185 CDD:188775 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.