DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lim-6

DIOPT Version :10

Sequence 1:NP_609359.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001256980.1 Gene:lim-6 / 180459 WormBaseID:WBGene00002988 Length:316 Species:Caenorhabditis elegans


Alignment Length:185 Identity:48/185 - (25%)
Similarity:79/185 - (42%) Gaps:23/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DTVETNSNISSSQLSFMDESS-NDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALDRYWHNGCL 103
            |.|:.:.....:.:|..|.|: .|.:...   |.:..|:|.|||..|.|||:...::..:|..||
 Worm     6 DIVDLDQPSLGTVISIKDGSTPTDISTTS---STTEDKLCSGCGCLIKDRYIYRVMEDSYHESCL 67

  Fly   104 KCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQ 168
            :|.||...|:.. ..||:|.|.|.|:.|:..::|..  |..|...:.|:::|             
 Worm    68 RCSCCQLSLSSF-KKCFSRHGNIYCEHDHQMLYGKR--CRRCMTLLLPTDIV------------- 116

  Fly   169 NQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWHKLLKGPANSN 223
               .::....:|.:||||..|......||.|.:....:.|..|:..:......||
 Worm   117 ---HRVHFMYYHAQCFSCCSCQRPFNLGDEYHVFDGEVFCRNDYQSICNFQTISN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_609359.1 LIM1_LMO4 78..132 CDD:188772 21/53 (40%)
LIM 142..212 CDD:413332 14/69 (20%)
lim-6NP_001256980.1 LIM 42..95 CDD:413332 21/53 (40%)
LIM 101..157 CDD:413332 14/73 (19%)
Homeodomain 187..243 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.