Sequence 1: | NP_001285799.1 | Gene: | CG5708 / 34361 | FlyBaseID: | FBgn0032196 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492696.1 | Gene: | lin-11 / 172893 | WormBaseID: | WBGene00003000 | Length: | 405 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 65/203 - (32%) |
---|---|---|---|
Similarity: | 91/203 - (44%) | Gaps: | 39/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 HTKDTVETNSNISSSQLSFMDE------SSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALD 95
Fly 96 RYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALT 160
Fly 161 GINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDR-YTMLGASLVCEQDWHKLLK--GPAN- 221
Fly 222 ----SNGT 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5708 | NP_001285799.1 | LIM1_LMO4 | 78..132 | CDD:188772 | 23/53 (43%) |
LIM | 142..212 | CDD:413332 | 23/70 (33%) | ||
lin-11 | NP_492696.1 | LIM | 68..123 | CDD:278823 | 25/57 (44%) |
LIM2_Lhx1_Lhx5 | 127..182 | CDD:188761 | 23/70 (33%) | ||
Homeobox | 244..297 | CDD:278475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2809 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |