DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lin-11

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_492696.1 Gene:lin-11 / 172893 WormBaseID:WBGene00003000 Length:405 Species:Caenorhabditis elegans


Alignment Length:203 Identity:65/203 - (32%)
Similarity:91/203 - (44%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HTKDTVETNSNISSSQLSFMDE------SSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALD 95
            |.:...:..|..||:.|..:|.      ||....:...|..|.    |..|...|.|||:...|.
 Worm    25 HQQSIEDVGSVTSSATLLLLDSATWMMPSSTTQPHISEISGNE----CAACAQPILDRYVFTVLG 85

  Fly    96 RYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALT 160
            :.||..||:|..|.|.::   .:||:|.||||||.|:|..:  |..|:||...:...:||.:|  
 Worm    86 KCWHQSCLRCCDCRAPMS---MTCFSRDGLILCKTDFSRRY--SQRCAGCDGKLEKEDLVRRA-- 143

  Fly   161 GINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDR-YTMLGASLVCEQDWHKLLK--GPAN- 221
                     :.|     |||:|||.|:.|...|..||: |.|.|...||:.|:....|  .|.: 
 Worm   144 ---------RDK-----VFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTATKTSTPTSI 194

  Fly   222 ----SNGT 225
                |||:
 Worm   195 HRPVSNGS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 23/53 (43%)
LIM 142..212 CDD:413332 23/70 (33%)
lin-11NP_492696.1 LIM 68..123 CDD:278823 25/57 (44%)
LIM2_Lhx1_Lhx5 127..182 CDD:188761 23/70 (33%)
Homeobox 244..297 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.