DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Isl1

DIOPT Version :10

Sequence 1:NP_609359.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_067434.3 Gene:Isl1 / 16392 MGIID:101791 Length:349 Species:Mus musculus


Alignment Length:139 Identity:46/139 - (33%)
Similarity:65/139 - (46%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LIKVCGGCGDKISDRYLL-YALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFG 137
            ||.:|.|||::|.|:|:| .:.|..||..||||..|...|.| ..:||.|.|...||:||..::|
Mouse    13 LISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDE-SCTCFVRDGKTYCKRDYIRLYG 76

  Fly   138 CSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTML 202
            ..  |:.|......::.|.:|.:.                |:|:.||.|..|...|.|||.:.:.
Mouse    77 IK--CAKCSIGFSKNDFVMRARSK----------------VYHIECFRCVACSRQLIPGDEFALR 123

  Fly   203 GASLVCEQD 211
            ...|.|..|
Mouse   124 EDGLFCRAD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_609359.1 LIM1_LMO4 78..132 CDD:188772 24/54 (44%)
LIM 142..212 CDD:413332 17/70 (24%)
Isl1NP_067434.3 LIM1_Isl 17..71 CDD:188752 24/54 (44%)
LIM2_Isl 79..133 CDD:188760 17/70 (24%)
HOX 181..237 CDD:197696
LIM-binding domain (LID) 262..291
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..349
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.