DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmo4a

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_817093.1 Gene:lmo4a / 114412 ZFINID:ZDB-GENE-010702-1 Length:167 Species:Danio rerio


Alignment Length:191 Identity:76/191 - (39%)
Similarity:106/191 - (55%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCG 109
            ||.:.||.::...            .|...::.|.|||.:||||:||:::|||||..||||.||.
Zfish     3 NSRVESSAVAVTG------------GSGGAVRSCAGCGGRISDRFLLFSMDRYWHTRCLKCSCCQ 55

  Fly   110 AMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQI 174
            |.|.|:||:||::.|:|||:.||..:||.||.||.||::||.||:|.:|...             
Zfish    56 AQLGEIGSTCFSKGGMILCRNDYIRLFGHSGACSACGQSIPASEMVMRAQGN------------- 107

  Fly   175 INCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQD--WHKLLKG---PANSNGTLGQRK 230
               |:||:||:||.|.:.|.||||:..:..::.||.|  ...||..   |..||..|..:|
Zfish   108 ---VYHLKCFTCATCRNRLVPGDRFHYVNGTIFCEHDRPGGALLSSHLTPLQSNTLLPDQK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 32/53 (60%)
LIM 142..212 CDD:413332 26/71 (37%)
lmo4aNP_817093.1 LIM1_LMO4 24..78 CDD:188772 32/53 (60%)
LIM2_LMO4 88..142 CDD:188773 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7097
eggNOG 1 0.900 - - E33208_3BFEA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45787
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17344
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.