Sequence 1: | NP_001285799.1 | Gene: | CG5708 / 34361 | FlyBaseID: | FBgn0032196 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_387501.1 | Gene: | Lmx1a / 110648 | MGIID: | 1888519 | Length: | 382 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 62/206 - (30%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 55/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 ENFAPIVIDYRNSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISD 87
Fly 88 RYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPS 152
Fly 153 ELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWHK--- 214
Fly 215 --LLKGPANSN 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5708 | NP_001285799.1 | LIM1_LMO4 | 78..132 | CDD:188772 | 21/53 (40%) |
LIM | 142..212 | CDD:413332 | 23/69 (33%) | ||
Lmx1a | NP_387501.1 | LIM1_Lmx1a | 35..86 | CDD:188756 | 21/53 (40%) |
LIM2_Lmx1a_Lmx1b | 94..148 | CDD:188764 | 23/69 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..208 | 2/4 (50%) | |||
Homeobox | 198..252 | CDD:365835 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 252..286 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |