DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Lmx1a

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_387501.1 Gene:Lmx1a / 110648 MGIID:1888519 Length:382 Species:Mus musculus


Alignment Length:206 Identity:62/206 - (30%)
Similarity:86/206 - (41%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ENFAPIVIDYRNSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISD 87
            |||             :..:||:::.||                .|..:.|...||.||...|||
Mouse     9 ENF-------------QSAIETSASFSS----------------LLGRAVSPKSVCEGCQRVISD 44

  Fly    88 RYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPS 152
            |:||...|.:||..|::|..|...|.   ::||.|...:.||..|..:|...  |.||.|.|.|:
Mouse    45 RFLLRLNDSFWHEQCVQCASCKEPLE---TTCFYRDKKLYCKYHYEKLFAVK--CGGCFEAIAPN 104

  Fly   153 ELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWHK--- 214
            |.|.:|            ||.    |:||.||.|..|...|:.||.:.:....|:|:.|:.|   
Mouse   105 EFVMRA------------QKS----VYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERE 153

  Fly   215 --LLKGPANSN 223
              .|..||.|:
Mouse   154 LLSLVSPAASD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 21/53 (40%)
LIM 142..212 CDD:413332 23/69 (33%)
Lmx1aNP_387501.1 LIM1_Lmx1a 35..86 CDD:188756 21/53 (40%)
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 23/69 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 2/4 (50%)
Homeobox 198..252 CDD:365835
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.