DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and Lmo3

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_036021636.1 Gene:Lmo3 / 109593 MGIID:102810 Length:172 Species:Mus musculus


Alignment Length:172 Identity:63/172 - (36%)
Similarity:89/172 - (51%) Gaps:30/172 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAM 111
            ||||.|:..:...:..             |.|.||..||.|||||.|||:|||..||||.||...
Mouse    22 NISSIQMLSVQPDTKP-------------KGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCR 73

  Fly   112 LAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIIN 176
            |.||||:.:|:..||||::||..:||.:|.|:.|.:.||..|:|.:|...               
Mouse    74 LGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDN--------------- 123

  Fly   177 CVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWHK-LLK 217
             |:||.||:|..|......||::.:....::|:.|:.: |:|
Mouse   124 -VYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 32/53 (60%)
LIM 142..212 CDD:413332 17/69 (25%)
Lmo3XP_036021636.1 LIM1_LMO1_LMO3 40..94 CDD:188774 32/53 (60%)
LIM2_LMO1_LMO3 104..158 CDD:188775 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.