DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and si:dkey-90l8.3

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_002663297.3 Gene:si:dkey-90l8.3 / 100330251 ZFINID:ZDB-GENE-081105-149 Length:156 Species:Danio rerio


Alignment Length:168 Identity:70/168 - (41%)
Similarity:101/168 - (60%) Gaps:18/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NQQLIHSNSLIKVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCK 129
            |.|:.....:.:.|.|||.:||||:||::::||||:.||||.||.|.|.|:||:|:::.|:|||:
Zfish     3 NSQVPGGVCVSRSCAGCGGRISDRFLLFSMERYWHSRCLKCSCCQAQLGEIGSTCYSKSGMILCR 67

  Fly   130 KDYSSMFGCSGVCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLR 194
            .||..:||.:|.||.||::||.||:|.:|...                |:||:|||||.|.:.|.
Zfish    68 TDYIRLFGHTGACSACGQSIPASEMVMRAQGN----------------VYHLKCFSCATCRNQLV 116

  Fly   195 PGDRYTMLGASLVCEQD--WHKLLKGPANSNGTLGQRK 230
            ||||:..:..::.||.|  ...||.....||..|..:|
Zfish   117 PGDRFHYVNGTIFCEHDRPGAALLNTHLQSNPVLPDQK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 30/53 (57%)
LIM 142..212 CDD:413332 27/71 (38%)
si:dkey-90l8.3XP_002663297.3 LIM1_LMO4 16..70 CDD:188772 30/53 (57%)
LIM2_LMO4 80..134 CDD:188773 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.