DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5708 and lmx1al

DIOPT Version :9

Sequence 1:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_009298059.1 Gene:lmx1al / 100149437 ZFINID:ZDB-GENE-131213-1 Length:406 Species:Danio rerio


Alignment Length:182 Identity:54/182 - (29%)
Similarity:83/182 - (45%) Gaps:38/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140
            :||.||...|:||:||...:..||..|:||..|.:.|:   .:|:.|..|:.||.||..:|  ..
Zfish    50 EVCAGCESPIADRFLLRVNELSWHETCVKCAVCRSALS---GTCYCRDRLLYCKHDYEKLF--VR 109

  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205
            .||.|.:.|..|||:.:                ::..|:||.||||.:|...|:.||.:.:....
Zfish   110 KCSACLQAIGRSELIMR----------------VLGQVYHLGCFSCCECERRLQRGDEFVLKEGQ 158

  Fly   206 LVCEQDWHK-------LLKGPANS---------NGTLGQRKGKVGRP-RRSK 240
            |:|..|:.|       :...|..|         ..::|.:.|..|:. :|||
Zfish   159 LLCRGDYEKEREMLAAISPAPTESVKSEDEEGGGVSVGGKAGDDGKEHKRSK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 20/53 (38%)
LIM 142..212 CDD:413332 20/69 (29%)
lmx1alXP_009298059.1 LIM1_Lmx1b 52..104 CDD:188757 21/54 (39%)
LIM 111..165 CDD:295319 20/69 (29%)
Homeobox 212..265 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.