DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and AT1G43910

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_175058.1 Gene:AT1G43910 / 840990 AraportID:AT1G43910 Length:475 Species:Arabidopsis thaliana


Alignment Length:278 Identity:80/278 - (28%)
Similarity:137/278 - (49%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YFDILEEARQLALEATEG-KTVLYTAMGAEWRP--FGHPRRRRPTGSVVLDRGTSQRIIADCQDF 209
            ||..|.::.:..:...|. |...|....::|..  |.|   .....::.::....:.:|.|...|
plant   163 YFTYLAKSAEKIMSHRENLKIYTYNQDRSKWESAIFEH---HTTFETLAVEPDLKKTLIDDLDAF 224

  Fly   210 IKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSERGLTDD-RLNHLLNV 273
            .|...::...|..::||||||||||.||||.:.|:|..::|.:  .:|..:.:.|| .|..:|..
plant   225 SKGKDFFKSVGRAWKRGYLLYGPPGTGKSSMVAAIANHMKYHI--YDLQIQSVRDDGELREILTS 287

  Fly   274 APEQSIILLEDID-AAFVSREATPQQKSAFDGLN-------------RITFSGLLNCLDGVGST- 323
            ...:||:|:|||| .|..||....::|....|.:             .|:.|||||.:||:.|: 
plant   288 TKNRSILLIEDIDCGADASRRRQSKKKEEDGGEDDGEPQKRKKKFEVGISLSGLLNFVDGLWSSC 352

  Fly   324 -EARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCTQYQLEEMFKNFFASSDTTKAEEFGKRVNS 387
             |.:|:..|||:.::|||||:||||:|:...:..||.:..:::...:..:.:....:...|.:..
plant   353 GEEKIIIFTTNHKEKLDPALLRPGRMDVHILMDNCTPFVFKKLVALYLKTDEHVLFDPIEKLILE 417

  Fly   388 FGRSASPAQIQGFFMKHK 405
            .  |::||::....|..|
plant   418 V--SSTPAEVTQQLMASK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 9/46 (20%)
RecA-like_BCS1 202..354 CDD:410918 63/168 (38%)
AT1G43910NP_175058.1 AAA_assoc 36..134 CDD:405113
P-loop_NTPase 217..384 CDD:422963 63/168 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2399
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1900
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532729at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.