DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and EMB3144

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_201263.2 Gene:EMB3144 / 836579 AraportID:AT5G64580 Length:855 Species:Arabidopsis thaliana


Alignment Length:266 Identity:73/266 - (27%)
Similarity:112/266 - (42%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 MGAEWRPFGHPRRRRPTGSVVLDRGTSQRIIAD-----------CQDFIKSSLW----------- 215
            :|...:....|.:|:..||  |.:..::.|.|:           .|::||..|.           
plant   278 LGTPTKKIRQPLKRQALGS--LGKSRAKFISAEEKTGVTFDDFAGQEYIKRELQEIVRILKNDEE 340

  Fly   216 YTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSE-----RGLTDDRLNHLL---- 271
            :..:||...:|.||:||||.||:....|:|||........|.::     .|:...|:..|.    
plant   341 FQNKGIYCPKGVLLHGPPGTGKTLLAKAIAGEAGLPFFAANGTDFVEMFVGVAASRVKDLFASSR 405

  Fly   272 NVAPEQSIILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCL---DGVGSTEARI-VFMTT 332
            :.||  |||.:::|| |..|:...|.    ..|.......|||..|   ||...|.::: |...|
plant   406 SYAP--SIIFIDEID-AIGSKRGGPD----IGGGGAEREQGLLQILTEMDGFKVTTSQVLVIGAT 463

  Fly   333 NYIDRLDPALVRPGRIDLKEYIGYCTQYQLEEMFK-----NFFASSDTTKAEEFGKRVNSFGRSA 392
            |.:|.|||||:|.||.|....:|..::.....:.|     .||.|.|  :.||..:.|.......
plant   464 NRLDILDPALLRKGRFDKIIRVGLPSKDGRLAILKVHARNKFFRSED--EKEELLQEVAENTEDF 526

  Fly   393 SPAQIQ 398
            :.|::|
plant   527 TGAELQ 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 4/18 (22%)
RecA-like_BCS1 202..354 CDD:410918 56/186 (30%)
EMB3144NP_201263.2 FtsH_fam 296..751 CDD:273520 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.