DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and ftsh9

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_568892.1 Gene:ftsh9 / 836004 AraportID:AT5G58870 Length:806 Species:Arabidopsis thaliana


Alignment Length:157 Identity:56/157 - (35%)
Similarity:75/157 - (47%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 DFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSE-----RGLTDDRL 267
            :|:|:...|.:.|....||.||.|.||.||:....|:|||.:......:.||     .|:...|:
plant   346 EFLKNPDRYVRLGARPPRGVLLVGLPGTGKTLLAKAVAGESDVPFISCSASEFVELYVGMGASRV 410

  Fly   268 NHLLNVAPEQ--SIILLEDIDAAFVSREATPQQKSAFDGLNRI--------TFSGLLNCLDGVGS 322
            ..|...|.::  |||.:::|||...||          ||..|:        |.:.||..:||..|
plant   411 RDLFARAKKEAPSIIFIDEIDAVAKSR----------DGKFRMVSNDEREQTLNQLLTEMDGFDS 465

  Fly   323 TEARIVFMTTNYIDRLDPALVRPGRID 349
            :.|.||...||..|.|||||.||||.|
plant   466 SSAVIVLGATNRADVLDPALRRPGRFD 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 56/157 (36%)
ftsh9NP_568892.1 FtsH_fam 322..759 CDD:273520 56/157 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.