DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and FTSH11

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_568787.1 Gene:FTSH11 / 835398 AraportID:AT5G53170 Length:806 Species:Arabidopsis thaliana


Alignment Length:393 Identity:86/393 - (21%)
Similarity:134/393 - (34%) Gaps:136/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YQWLLKWITIRGARKTQHLSVETNFVQND---NGTIKTSYDFIPSIGKHL-------FQYKGNWI 114
            ::||..|...|..::.:.|..|.:....|   .|.:      :..:.||:       |:.:.:.:
plant   161 WEWLSWWPFSRQEKRLEKLIAEADANPKDAALQGAL------LAELNKHIPEAVVQRFEQREHTV 219

  Fly   115 QVERTRE------------QQTLDLHMGVPWETVTL------TAFGN------NKGIYFDILEEA 155
            ......|            :...|...|.|.....|      .|.||      |.||     .|.
plant   220 DSRGVAEYIRALVITNAISEYLPDEQTGKPSSLPALLQELKHRASGNMDESFVNPGI-----SEK 279

  Fly   156 RQLALEATEGK-------------TVLYT-AMGAEWRPFGHPRRRRPTGSVVLDR--------GT 198
            :.|.:.....|             |:|:| |:|..|          ..|:..|.:        ||
plant   280 QPLHVTMVNPKVSNKSRFAQELVSTILFTVAVGLVW----------IMGAAALQKYIGSLGGIGT 334

  Fly   199 SQ-------------------------RIIADCQD----------FIKSSLWYTQRGIPYRRGYL 228
            |.                         :.:..|.|          ::|:...:|:.|....:|.|
plant   335 SGVGSSSSYSPKELNKEITPEKNVKTFKDVKGCDDAKQELEEVVEYLKNPSKFTRLGGKLPKGIL 399

  Fly   229 LYGPPGCGKSSFITALAGEL----------EYSVCLLNLSERGLTDDRLNHLLNVAPEQS--IIL 281
            |.|.||.||:....|:|||.          |:....:.:..|     |:..|...|.:::  ||.
plant   400 LTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGAR-----RVRSLFQAAKKKAPCIIF 459

  Fly   282 LEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMTTNYIDRLDPALVRPG 346
            :::|||...:|:       .::|..:.|...||..:||....|..||...||..|.|||||.|||
plant   460 IDEIDAVGSTRK-------QWEGHTKKTLHQLLVEMDGFEQNEGIIVMAATNLPDILDPALTRPG 517

  Fly   347 RID 349
            |.|
plant   518 RFD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 32/179 (18%)
RecA-like_BCS1 202..354 CDD:410918 50/170 (29%)
FTSH11NP_568787.1 FtsH_fam 355..784 CDD:273520 50/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.