DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and AATP1

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_198817.1 Gene:AATP1 / 833998 AraportID:AT5G40010 Length:514 Species:Arabidopsis thaliana


Alignment Length:323 Identity:94/323 - (29%)
Similarity:146/323 - (45%) Gaps:64/323 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 TEGKTV--------LYTAMGAE---------WR--PFGHPRRRRPTGSVVLDRGTSQRIIADCQD 208
            :||||:        ||:...::         |.  .|.||   ....::.::....:.|..|...
plant   166 SEGKTIEVKNRERKLYSNNPSQNWSGYKQTKWSHVTFEHP---ATFDTLAMEYKKKEEIKNDLIK 227

  Fly   209 FIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSERGLTDD-RLNHLLN 272
            |..|..:|.:.|..::|||||:||||.|||:.|.|:|..|||.|..|.|:.  :.|: .|..||.
plant   228 FSNSKDYYKKIGKAWKRGYLLFGPPGTGKSTMIAAMANLLEYDVYDLELTT--VKDNTELRRLLI 290

  Fly   273 VAPEQSIILLEDIDAAFVSREATPQQKSAFD-------------------GLN---RITFSGLLN 315
            ....:|||::||||.   |.:.|.|:|...|                   |.|   ::|.|||||
plant   291 ETSGKSIIVIEDIDC---SLDLTGQRKQKKDEEEDEDETSPIEKQMKKDQGENKGSKVTLSGLLN 352

  Fly   316 CLDGVGST--EARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCTQYQLEEMFKNFFASSDTTKA 378
            .:||:.|.  ..||:..|||:||:|||||:|.||:|....:.||.....:.:..|:..:.:....
plant   353 FIDGLWSACGGERIIVFTTNFIDKLDPALIRKGRMDKHIEMSYCGFEAFKVLANNYLDAKEEDDN 417

  Fly   379 EEFG--KRVNSFGR-SASPAQI-QGFFMKHKLSSPQTVI--------DSCEDIWENVLDHNKK 429
            |.|.  ||:..... ..:||.: :....|.::.:.:..:        :..|:....:.|..||
plant   418 ELFDEIKRLLEVEEIKMTPADVGENLLKKSEVETKEICLKRLIEALKEEKEEAKRRIEDEEKK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 10/47 (21%)
RecA-like_BCS1 202..354 CDD:410918 70/176 (40%)
AATP1NP_198817.1 AAA_assoc 29..124 CDD:291061
AAA 243..393 CDD:214640 64/154 (42%)
AAA 246..395 CDD:278434 62/153 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2399
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1900
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532729at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23070
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
99.020

Return to query results.
Submit another query.