DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and RPT2a

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_194633.1 Gene:RPT2a / 829025 AraportID:AT4G29040 Length:443 Species:Arabidopsis thaliana


Alignment Length:179 Identity:59/179 - (32%)
Similarity:83/179 - (46%) Gaps:19/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 YTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYS---VCLLNLSERGLTD--DRLNHLLNVAP 275
            |...||...:|.:|||.||.||:....|:|.....:   |....|.::.|.|  ..:..|..||.
plant   214 YEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD 278

  Fly   276 E--QSIILLEDIDAAFVSREATPQQKSAFDGLNR---ITFSGLLNCLDGVGSTEARIVFMTTNYI 335
            :  .||:.:::|||....|      ..|..|..|   .|...|||.|||..|.....|.:.||.|
plant   279 DLSPSIVFIDEIDAVGTKR------YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRI 337

  Fly   336 DRLDPALVRPGRIDLK-EY--IGYCTQYQLEEMFKNFFASSDTTKAEEF 381
            :.|||||:||||||.| |:  ....|:.::.::..:....|:....|||
plant   338 ESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLSEDVNLEEF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 54/150 (36%)
RPT2aNP_194633.1 PTZ00361 7..443 CDD:185575 59/179 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.