DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and AT4G05380

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001319874.1 Gene:AT4G05380 / 825886 AraportID:AT4G05380 Length:460 Species:Arabidopsis thaliana


Alignment Length:206 Identity:69/206 - (33%)
Similarity:107/206 - (51%) Gaps:30/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 IIADCQDFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSERGLTDD- 265
            :|.|...|.....::...|..::||||||||||.||||.:.|:|..:.||:  .:|..:.:.|| 
plant   221 LIRDLDAFSNGKDFFKTVGRAWKRGYLLYGPPGTGKSSLVAAIANFMNYSI--YDLQIQSVKDDA 283

  Fly   266 RLNHLLNVAPEQSIILLEDIDAAFVSREATPQQKSAFD-GLN---------RITFSGLLNCLDGV 320
            .|..:|.....:||:|:||:|.:........:.|...: |.|         ::|.|||||.:||:
plant   284 MLRQILTSTENRSILLIEDLDCSGADTTCRKENKDETEYGENQNKKKKKDPKVTLSGLLNFVDGL 348

  Fly   321 GST--EARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCT---------------QYQLEEMFKN 368
            .|:  |.||:..|||:.::|||||:||||:|:...:.|||               :::|.:..:.
plant   349 WSSCVEERIIIFTTNHKEKLDPALLRPGRMDVHILMDYCTPIVFKKLAALYLEIEEHELFDPIEK 413

  Fly   369 FFASSDTTKAE 379
            .|.....|.||
plant   414 MFLEVKATPAE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 61/164 (37%)
AT4G05380NP_001319874.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2399
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1900
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532729at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X279
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.