DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcs1 and AT4G05340

DIOPT Version :10

Sequence 1:NP_609358.1 Gene:Bcs1 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_192443.1 Gene:AT4G05340 / 825882 AraportID:AT4G05340 Length:96 Species:Arabidopsis thaliana


Alignment Length:54 Identity:24/54 - (44%)
Similarity:38/54 - (70%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 RITFSGLLNCLDGV--GSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCT 358
            :::.||||..:||:  .|.|.||:..|||:.::||||.:|||::|:...:.|||
plant    26 QVSLSGLLYFVDGLWSNSVEERIIIFTTNHKEKLDPAFLRPGKMDVHILMDYCT 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcs1NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 21/48 (44%)
AT4G05340NP_192443.1 P-loop containing Nucleoside Triphosphate Hydrolases <6..75 CDD:476819 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.