powered by:
Protein Alignment CG4908 and AT4G05340
DIOPT Version :9
Sequence 1: | NP_609358.1 |
Gene: | CG4908 / 34360 |
FlyBaseID: | FBgn0032195 |
Length: | 431 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192443.1 |
Gene: | AT4G05340 / 825882 |
AraportID: | AT4G05340 |
Length: | 96 |
Species: | Arabidopsis thaliana |
Alignment Length: | 54 |
Identity: | 24/54 - (44%) |
Similarity: | 38/54 - (70%) |
Gaps: | 2/54 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 307 RITFSGLLNCLDGV--GSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCT 358
:::.||||..:||: .|.|.||:..|||:.::||||.:|||::|:...:.|||
plant 26 QVSLSGLLYFVDGLWSNSVEERIIIFTTNHKEKLDPAFLRPGKMDVHILMDYCT 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0465 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D532729at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.