DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and AT4G05340

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_192443.1 Gene:AT4G05340 / 825882 AraportID:AT4G05340 Length:96 Species:Arabidopsis thaliana


Alignment Length:54 Identity:24/54 - (44%)
Similarity:38/54 - (70%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 RITFSGLLNCLDGV--GSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCT 358
            :::.||||..:||:  .|.|.||:..|||:.::||||.:|||::|:...:.|||
plant    26 QVSLSGLLYFVDGLWSNSVEERIIIFTTNHKEKLDPAFLRPGKMDVHILMDYCT 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 21/48 (44%)
AT4G05340NP_192443.1 P-loop_NTPase <6..75 CDD:422963 21/48 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532729at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.