DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and AT3G28560

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_189497.1 Gene:AT3G28560 / 822486 AraportID:AT3G28560 Length:257 Species:Arabidopsis thaliana


Alignment Length:190 Identity:43/190 - (22%)
Similarity:62/190 - (32%) Gaps:70/190 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TIRGARKTQHLSVETNFVQNDNGTIKTSYDFIPSIGKH-----LFQ-YKGNWIQVERTREQQ--- 123
            ||.....|:..::......|::   |.|...:.|:..|     :|| .|..|....|..:.|   
plant    65 TIHNYLSTKSTALGNRLKANES---KKSKSLVLSLDDHETVEDVFQGVKVKWSSSVRENQNQSST 126

  Fly   124 ------------TLDLHMGVPWETVTLTAFGNNKGIYFD-ILEEARQLALEATEGKTVLYT---- 171
                        ||..| ....|.:|.|        |.| :|.|.:::.|:..|.|  |||    
plant   127 NRDKGFAERRYLTLSFH-SRHREMITTT--------YLDHVLREGKEIGLKKRERK--LYTNNSS 180

  Fly   172 ------AMGAEWR--PFGHP---------------------RRRRPTGSVV-LDRGTSQR 201
                  .:|..|.  .|.||                     :|||..|.:: ..|.|.||
plant   181 HEWISWRLGTNWSNVSFDHPATLETFAMDPEKNKAEKEAWKKRRRKRGRLLRKKRRTKQR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 39/178 (22%)
RecA-like_BCS1 202..354 CDD:410918 43/190 (23%)
AT3G28560NP_189497.1 AAA_assoc 29..117 CDD:373025 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532729at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23070
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.