DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and EMB2083

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_566541.1 Gene:EMB2083 / 820876 AraportID:AT3G16290 Length:876 Species:Arabidopsis thaliana


Alignment Length:231 Identity:68/231 - (29%)
Similarity:101/231 - (43%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LEEARQLALEATEGKTVLYTAMGAEWRPFGHPRRRRPTGSVV---LDRGTSQRI----------- 202
            :||..:...|.| |:...|..|..::...| .|.||.:...:   |:||...:.           
plant   358 IEEEDEEVEEGT-GEKNPYLQMAMQFMKSG-ARVRRASNKRLPEYLERGVDVKFTDVAGLGKIRL 420

  Fly   203 -IADCQDFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSE-----RG 261
             :.:...|......|.:||:....|.||.||||.||:....|:|||...:...::.|:     .|
plant   421 ELEEIVKFFTHGEMYRRRGVKIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFVEIYVG 485

  Fly   262 LTDDRLNHLLNVAPEQ--SIILLEDIDAAFVSRE------ATPQQKSAFDGLNRITFSGLLNCLD 318
            :...|:..|...|.|.  |::.::::||  |.||      :..|::.|       |.:.||..||
plant   486 VGASRVRALYQEARENAPSVVFIDELDA--VGRERGLIKGSGGQERDA-------TLNQLLVSLD 541

  Fly   319 GVGSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYI 354
            |.......|...:||..|.||||||||||.|.|.:|
plant   542 GFEGRGEVITIASTNRPDILDPALVRPGRFDRKIFI 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 11/39 (28%)
RecA-like_BCS1 202..354 CDD:410918 53/176 (30%)
EMB2083NP_566541.1 FtsH_fam 378..837 CDD:273520 62/210 (30%)
AAA 446..578 CDD:278434 49/141 (35%)
Peptidase_M41 666..832 CDD:279742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.