DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and spg7

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_001923118.1 Gene:spg7 / 794740 ZFINID:ZDB-GENE-030131-5391 Length:788 Species:Danio rerio


Alignment Length:262 Identity:68/262 - (25%)
Similarity:116/262 - (44%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MGVPWETVTLTAFGNNKGIY--FDILEEARQLALEATEGKTVLYTAMGAEWRPFGHPRRRRPTGS 191
            :.:.|....|...|...|.:  |:.|:.|:...::...||       |..::.....|.      
Zfish   256 VAILWYIFRLAGMGGRDGGFSAFNQLKMAKFTIVDGKSGK-------GVSFKDVAGMRE------ 307

  Fly   192 VVLDRGTSQRIIADCQDFIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLN 256
                   ::..:.:..|::|:...|.|.|....:|.||.|||||||:....|:|.|.:.....:.
Zfish   308 -------AKMEVKEFVDYLKNPDRYLQLGAKVPKGSLLLGPPGCGKTLLAKAVATEAQVPFLAMA 365

  Fly   257 LSE-----RGLTDDRLNHLLNVAPEQS--IILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLL 314
            .||     .||...|:..|...|..::  |:.:::|||  |.::.:.......:.....|.:.||
Zfish   366 GSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDA--VGKKRSTNMSGFSNTEEEQTLNQLL 428

  Fly   315 NCLDGVGSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIGYCTQYQLEEMFKNFFASSDTTKAE 379
            ..:||:|:|:..||..:||..|.||.||:||||:|...:|...|..:.:|:|:........|:..
Zfish   429 VEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKILKLTQPA 493

  Fly   380 EF 381
            :|
Zfish   494 DF 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 11/64 (17%)
RecA-like_BCS1 202..354 CDD:410918 51/158 (32%)
spg7XP_001923118.1 FtsH_ext 136..233 CDD:284011
FtsH_fam 257..738 CDD:273520 68/261 (26%)
AAA 337..470 CDD:278434 46/134 (34%)
Peptidase_M41 552..736 CDD:279742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.