DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and Spata5l1

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001103117.1 Gene:Spata5l1 / 691729 RGDID:1595990 Length:747 Species:Rattus norvegicus


Alignment Length:214 Identity:66/214 - (30%)
Similarity:98/214 - (45%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GKTVLYTAMGAEWRPFGHPRRRRPTGSVVLDRGTSQRIIAD-CQDFIKSSLWY----TQRGIPYR 224
            |:...:|.:....:|   |.:..|.|.|.|. |.|:  .|| .::.::..|.|    ...|:...
  Rat   169 GRVTPHTRITLSDKP---PPQVEPPGEVTLG-GLSE--TADSLRELLRLPLCYPLALAALGLAVP 227

  Fly   225 RGYLLYGPPGCGKSSFITALAGE-----LEYSVCLLNLSERGLTDDRLNHLLNVAPE-----QSI 279
            ||.||.||||.||:..:.|:|.|     |..|...|..:..|.|::.:..:...|.|     .|:
  Rat   228 RGVLLAGPPGVGKTQLVRAVAREAGAELLAVSAPALQGTRPGETEENVRRVFQRAQELASRGPSL 292

  Fly   280 ILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMTTNYIDRLDPALVR 344
            :.|:::| |...|...||:...    :|:. :.:|..|||:......:|...||..|.|||||.|
  Rat   293 LFLDEVD-ALCPRRGGPQRAPE----SRVV-AQVLTLLDGIHGDREVVVVGATNRPDELDPALRR 351

  Fly   345 PGRIDLKEYIGYCTQYQLE 363
            |||.|.:..||..|..|.|
  Rat   352 PGRFDREVIIGTPTLKQRE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 6/26 (23%)
RecA-like_BCS1 202..354 CDD:410918 51/166 (31%)
Spata5l1NP_001103117.1 CDC48 14..738 CDD:273521 66/214 (31%)
AAA 230..362 CDD:278434 44/137 (32%)
AAA 496..646 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.