DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and Psmc6

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_080235.2 Gene:Psmc6 / 67089 MGIID:1914339 Length:389 Species:Mus musculus


Alignment Length:218 Identity:63/218 - (28%)
Similarity:102/218 - (46%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LEEARQLALEATEGKTVLYTAMGAEWRPFGHPRRRRPTGSVVLDR--GTSQRIIADCQDFIKSSL 214
            |:...::||:.|....:.|  :..|..|..:.......|:|....  |.|:: |.:.::.|:..|
Mouse    92 LKPGTRVALDMTTLTIMRY--LPREVDPLVYNMSHEDPGNVSYSEIGGLSEQ-IRELREVIELPL 153

  Fly   215 ----WYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSERGLTDD-------RLN 268
                .:.:.||...:|.|||||||.||:....|:|.:|:.:  .|.:....:.|.       .:.
Mouse   154 TNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCN--FLKVVSSSIVDKYIGESARLIR 216

  Fly   269 HLLNVAPEQS--IILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMT 331
            .:.|.|.:..  ||.:::|||  :......:..||...:.| |...|||.:||..:.....:.|.
Mouse   217 EMFNYARDHQPCIIFMDEIDA--IGGRRFSEGTSADREIQR-TLMELLNQMDGFDTLHRVKMIMA 278

  Fly   332 TNYIDRLDPALVRPGRIDLKEYI 354
            ||..|.|||||:||||:|.|.:|
Mouse   279 TNRPDTLDPALLRPGRLDRKIHI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 8/39 (21%)
RecA-like_BCS1 202..354 CDD:410918 51/164 (31%)
Psmc6NP_080235.2 RPT1 4..387 CDD:224143 63/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.