DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and nmd

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:205 Identity:58/205 - (28%)
Similarity:86/205 - (41%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGE-----LEYSVCLLNLSERGLTDDRLN 268
            |..|.||...:|:      ||:|||||||:....|.|.|     :...|.:|.....|.:....:
  Fly   123 FKHSKLWQAPKGV------LLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTS 181

  Fly   269 HLLNVAP--EQSIILLEDIDAAFVSR-----EATPQQKSAF----DGLNRITFSGLLNCLDGVGS 322
            .:.::|.  |..||.:::||:...||     |||...|:.|    |||                |
  Fly   182 AVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGL----------------S 230

  Fly   323 TEAR---IVFMTTNYIDRLDPALVRPGRIDLKEYIGYCTQYQLEEMFKNFFASSDTTK---AEEF 381
            |.|.   ||...||....||.|:||  |:..:.:||..::.|.:::.|....|.:.::   ....
  Fly   231 TNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRL 293

  Fly   382 GKRVNSFGRS 391
            .|..|.|..|
  Fly   294 SKLTNGFSGS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 49/163 (30%)
nmdNP_001285801.1 AAA 132..266 CDD:214640 47/157 (30%)
AAA 135..265 CDD:278434 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.