DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and CG6512

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_730248.2 Gene:CG6512 / 39922 FlyBaseID:FBgn0036702 Length:826 Species:Drosophila melanogaster


Alignment Length:291 Identity:75/291 - (25%)
Similarity:117/291 - (40%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 WIQVERTREQQTLDLHMGVPWETV--------TLTAFGNNKG---------IYFDILEEARQLAL 160
            |:   |.|.||..:...||.|..:        .|.|....:|         ||.:.:|.|....|
  Fly   213 WV---RVRLQQNSNSGSGVLWFNIGSVDSFERNLEAAQTEQGTESINFVPVIYRNEVEAASLTGL 274

  Fly   161 EAT---EGKTVLYTAMGAEWRPFGHPRRRRPTGSVVL----------DRGTSQRIIADCQD---- 208
            ..|   .|..|......|:....|..|:.......|:          :.|...:.:|.|::    
  Fly   275 LPTLLIIGFLVYMMRKSADMMGGGRGRKGGGLFGGVMQSTAKLTNPNEIGVGFKDVAGCEEAKIE 339

  Fly   209 ------FIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSE-----RGL 262
                  |:|:...|...|....:|.:|.||||.||:....|.|||.......::.||     .|:
  Fly   340 IMEFVNFLKNPQQYIDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGV 404

  Fly   263 TDDRLNHLLNVAPEQS--IILLEDIDAAFVSREATPQQKSAFDGLN--RITFSGLLNCLDGVGST 323
            ...|:..:..:|.:.:  |:.:::|||  |.|:   :....|.|.:  ..|.:.||..:||..:|
  Fly   405 GPSRVRDMFAMARKHAPCILFIDEIDA--VGRK---RGGKTFGGHSEQENTLNQLLVEMDGFNTT 464

  Fly   324 EARIVFMTTNYIDRLDPALVRPGRIDLKEYI 354
            ...:|...||.:|.||.||:||||.|.:.|:
  Fly   465 TNVVVLAATNRVDILDKALMRPGRFDRQIYV 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 22/98 (22%)
RecA-like_BCS1 202..354 CDD:410918 50/170 (29%)
CG6512NP_730248.2 FtsH_ext 163..259 CDD:284011 11/48 (23%)
FtsH_fam 271..764 CDD:273520 60/230 (26%)
AAA 365..496 CDD:278434 44/136 (32%)
Peptidase_M41 580..762 CDD:279742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.