DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and TER94

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001097249.1 Gene:TER94 / 36040 FlyBaseID:FBgn0286784 Length:826 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:107/260 - (41%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VPWETVTLTAFGNNKGIYFD--ILEEARQL----------ALEATEGKTVL-----YTAMGAEWR 178
            :|.:..|....||...||..  .||..|.:          |:...|.|.||     |..:..|..
  Fly   139 LPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETV 203

  Fly   179 PF--GHPRRRRPTGSVVL-----DRGTSQRIIADCQDFIKSSL----WYTQRGIPYRRGYLLYGP 232
            .|  |.|.:|......:.     |.|..::.:|..::.::..|    .:...|:...||.|:|||
  Fly   204 IFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGP 268

  Fly   233 PGCGKSSFITALAGELEYSVCLLNLSE-----RGLTDDRLNHLLNVAPEQS--IILLEDIDAAFV 290
            ||.||:....|:|.|......|:|..|     .|.::..|......|.:.|  ||.:::|||...
  Fly   269 PGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAP 333

  Fly   291 SREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIG 355
            .|:.|..:      :.|...|.||..:||:..:...||...||..:.:||||.|.||.|.:..||
  Fly   334 KRDKTHGE------VERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIG 392

  Fly   356  355
              Fly   393  392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 20/79 (25%)
RecA-like_BCS1 202..354 CDD:410918 48/162 (30%)
TER94NP_001097249.1 CDC48 47..787 CDD:273521 72/260 (28%)
CDC48_N 47..129 CDD:280513
CDC48_2 153..213 CDD:215011 15/59 (25%)
AAA 263..392 CDD:278434 43/134 (32%)
AAA 536..669 CDD:278434
Vps4_C <741..783 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.