DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and F56F11.4

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001367906.1 Gene:F56F11.4 / 175403 WormBaseID:WBGene00018991 Length:432 Species:Caenorhabditis elegans


Alignment Length:139 Identity:54/139 - (38%)
Similarity:71/139 - (51%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNLSER-----GLTDDRLNHLLNVAPEQ-- 277
            ||...:|.|||||||.||:....|:|...|.:...::.||.     |.....:..|..:|.|.  
 Worm   205 GIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAP 269

  Fly   278 SIILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLNCLDGVGSTEARIVFMTTNYIDRLDPAL 342
            |||.:::||:...||   .:.....|...:.|...|||.|||..:|:...|.|.||.||.||.||
 Worm   270 SIIFMDEIDSIGSSR---VEGSRGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSAL 331

  Fly   343 VRPGRIDLK 351
            :||||||.|
 Worm   332 LRPGRIDRK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 54/139 (39%)
F56F11.4NP_001367906.1 RPT1 51..430 CDD:224143 54/139 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.